SCOPe 2.08: Domain d3l6qb2: 3l6q B:207-398

Lineage for d3l6qb2 (3l6q B:207-398)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [225813] (2 PDB entries)

8. Domain d3l6qb2: 3l6q B:207-398 [212744]
   Other proteins in same PDB: d3l6qa3, d3l6qb3
   automated match to d1ngfa2
   complexed with mg, so4

Details for d3l6qb2

PDB Entry: 3l6q, 2.29 Å

PDB Description: crystal structure of the n-terminal domain of hsp70 from cryptosporidium parvum (cgd2_20)

PDB Compounds: (B:) Heat shock 70 (HSP70) protein

SCOPe Domain Sequences for d3l6qb2:

Sequence; same for both SEQRES and ATOM records:

>d3l6qb2 c.55.1.0 (B:207-398) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gernvlifdlgggtfdvslltiedgifevkatagdthlggedfdnrlvefcvqdfkrknr
gmdlttnaralrrlrtqcerakrtlssstqatieldslyegidysvaisrarfeelcady
fratlapvekvlkdagmdkrsvhdvvlvggstripkvqaliqeffngkepckainpdeav
aygaavqaailn

Timeline for d3l6qb2:

• d3l6qb2 first appeared in SCOPe 2.03
  
• d3l6qb2 appears in SCOPe 2.07