Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries) |
Domain d2hmic2: 2hmi C:108-214 [21274] Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib_, d2hmic1, d2hmid1, d2hmid2 part of Fab 28 against HIV-1 RT |
PDB Entry: 2hmi (more details), 2.8 Å
SCOP Domain Sequences for d2hmic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmic2 b.1.1.2 (C:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqd skdstysmsstltltadeyeaansytcaathktstspivksfnanec
Timeline for d2hmic2: