Lineage for d3l3la2 (3l3l A:136-350)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234080Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 2234081Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 2234090Species Human (Homo sapiens) [TaxId:9606] [103339] (8 PDB entries)
    Uniprot P09874 661-1010
  8. 2234095Domain d3l3la2: 3l3l A:136-350 [212736]
    Other proteins in same PDB: d3l3la1
    automated match to d1gs0a2
    protein/DNA complex; complexed with l3l

Details for d3l3la2

PDB Entry: 3l3l (more details), 2.5 Å

PDB Description: parp complexed with a906894
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d3l3la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l3la2 d.166.1.2 (A:136-350) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d3l3la2:

Click to download the PDB-style file with coordinates for d3l3la2.
(The format of our PDB-style files is described here.)

Timeline for d3l3la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l3la1