SCOPe 2.06: Domain d3l3la1: 3l3l A:1-135

Lineage for d3l3la1 (3l3l A:1-135)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)

6. Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101198] (8 PDB entries)
   Uniprot P09874 661-1010

8. Domain d3l3la1: 3l3l A:1-135 [212735]
   Other proteins in same PDB: d3l3la2
   automated match to d1gs0a1
   protein/DNA complex; complexed with l3l

Details for d3l3la1

PDB Entry: 3l3l, 2.5 Å

PDB Description: parp complexed with a906894

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d3l3la1:

Sequence; same for both SEQRES and ATOM records:

>d3l3la1 a.41.1.1 (A:1-135) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

Timeline for d3l3la1:

• d3l3la1 first appeared in SCOPe 2.03
  
• d3l3la1 appears in SCOPe 2.05
  
• d3l3la1 appears in SCOPe 2.07
  
• d3l3la1 appears in the current release, SCOPe 2.08