![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
![]() | Protein automated matches [227028] (5 species) not a true protein |
![]() | Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries) |
![]() | Domain d3l2gq2: 3l2g Q:114-390 [212726] Other proteins in same PDB: d3l2ga1, d3l2gb1, d3l2gc1, d3l2gd1, d3l2ge1, d3l2gf1, d3l2gg1, d3l2gh1, d3l2gi1, d3l2gj1, d3l2gk1, d3l2gl1, d3l2gm1, d3l2gn1, d3l2go1, d3l2gp1, d3l2gq1, d3l2gr1 automated match to d1qh4a2 complexed with adp, mg, nmg, no3 |
PDB Entry: 3l2g (more details), 2.3 Å
SCOPe Domain Sequences for d3l2gq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2gq2 d.128.1.0 (Q:114-390) automated matches {Namalycastis sp. [TaxId: 243920]} sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl gkserelvqvlvdgvnlliacdkkleagqsiddmipk
Timeline for d3l2gq2:
![]() Domains from other chains: (mouse over for more information) d3l2ga1, d3l2ga2, d3l2gb1, d3l2gb2, d3l2gc1, d3l2gc2, d3l2gd1, d3l2gd2, d3l2ge1, d3l2ge2, d3l2gf1, d3l2gf2, d3l2gg1, d3l2gg2, d3l2gh1, d3l2gh2, d3l2gi1, d3l2gi2, d3l2gj1, d3l2gj2, d3l2gk1, d3l2gk2, d3l2gl1, d3l2gl2, d3l2gm1, d3l2gm2, d3l2gn1, d3l2gn2, d3l2go1, d3l2go2, d3l2gp1, d3l2gp2, d3l2gr1, d3l2gr2 |