Lineage for d1adql2 (1adq L:108-215)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934961Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 934965Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 935028Domain d1adql2: 1adq L:108-215 [21272]
    Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh1, d1adqh2, d1adql1
    part of IgM rheumatoid factor Fab

Details for d1adql2

PDB Entry: 1adq (more details), 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
PDB Compounds: (L:) igm-lambda rf-an fab (light chain)

SCOPe Domain Sequences for d1adql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adql2 b.1.1.2 (L:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d1adql2:

Click to download the PDB-style file with coordinates for d1adql2.
(The format of our PDB-style files is described here.)

Timeline for d1adql2: