Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88572] (33 PDB entries) |
Domain d1adql2: 1adq L:108-215 [21272] Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh1, d1adqh2, d1adql1 part of IgM rheumatoid factor Fab |
PDB Entry: 1adq (more details), 3.15 Å
SCOP Domain Sequences for d1adql2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adql2 b.1.1.2 (L:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvetttpskq snnkyaassylsltpeqwkshksyscqvthegstvektvaptecs
Timeline for d1adql2:
View in 3D Domains from other chains: (mouse over for more information) d1adqa1, d1adqa2, d1adqh1, d1adqh2 |