SCOP 1.55: Domain d1adql2: 1adq L:108-215

Lineage for d1adql2 (1adq L:108-215)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species IgM rheumatoid factor Fab (human), lambda L chain [49067] (1 PDB entry)

8. Domain d1adql2: 1adq L:108-215 [21272]
   Other proteins in same PDB: d1adqh1, d1adql1

Details for d1adql2

PDB Entry: 1adq, 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adql2:

Sequence; same for both SEQRES and ATOM records:

>d1adql2 b.1.1.2 (L:108-215) Immunoglobulin (constant domains of L and H chains) {IgM rheumatoid factor Fab (human), lambda L chain}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvaptecs

Timeline for d1adql2:

• d1adql2 appears in SCOP 1.57
  
• d1adql2 appears in the current release, SCOPe 2.08