Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries) |
Domain d1g9nh2: 1g9n H:130-229 [21267] Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh1, d1g9nl1 |
PDB Entry: 1g9n (more details), 2.9 Å
SCOP Domain Sequences for d1g9nh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9nh2 b.1.1.2 (H:130-229) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain} stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1g9nh2: