SCOP 1.55: Domain d1g9nh2: 1g9n H:130-229

Lineage for d1g9nh2 (1g9n H:130-229)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries)

8. Domain d1g9nh2: 1g9n H:130-229 [21267]
   Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh1, d1g9nl1

Details for d1g9nh2

PDB Entry: 1g9n, 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9nh2:

Sequence; same for both SEQRES and ATOM records:

>d1g9nh2 b.1.1.2 (H:130-229) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1g9nh2:

• d1g9nh2 appears in SCOP 1.57
  
• d1g9nh2 appears in the current release, SCOPe 2.08