SCOPe 2.06: Domain d3l2ea2: 3l2e A:114-390

Lineage for d3l2ea2 (3l2e A:114-390)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (5 species)
   not a true protein

7. Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries)

8. Domain d3l2ea2: 3l2e A:114-390 [212656]
   Other proteins in same PDB: d3l2ea1, d3l2eb1, d3l2ec1, d3l2ed1
   automated match to d2crka2

Details for d3l2ea2

PDB Entry: 3l2e, 2.6 Å

PDB Description: Glycocyamine kinase, alpha-beta heterodimer from marine worm Namalycastis sp.

PDB Compounds: (A:) Glycocyamine kinase alpha chain

SCOPe Domain Sequences for d3l2ea2:

Sequence; same for both SEQRES and ATOM records:

>d3l2ea2 d.128.1.0 (A:114-390) automated matches {Namalycastis sp. [TaxId: 243920]}
sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal
gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne
knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict
cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl
gkserelvqvlvdgvnlliacdkkleagqsiddmipk

Timeline for d3l2ea2:

• d3l2ea2 first appeared in SCOPe 2.03
  
• d3l2ea2 appears in SCOPe 2.05
  
• d3l2ea2 appears in SCOPe 2.07
  
• d3l2ea2 appears in the current release, SCOPe 2.08