![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
![]() | Protein automated matches [227028] (5 species) not a true protein |
![]() | Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries) |
![]() | Domain d3l2dc2: 3l2d C:114-390 [212652] Other proteins in same PDB: d3l2da1, d3l2db1, d3l2dc1, d3l2dd1 automated match to d1qh4a2 |
PDB Entry: 3l2d (more details), 2.4 Å
SCOPe Domain Sequences for d3l2dc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2dc2 d.128.1.0 (C:114-390) automated matches {Namalycastis sp. [TaxId: 243920]} sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl gkserelvqvlvdgvnlliacdkkleagqsiddmipk
Timeline for d3l2dc2: