Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1gc1h2: 1gc1 H:130-229 [21265] Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h1, d1gc1l1, d1gc1l2 part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120 complexed with fuc, nag; mutant |
PDB Entry: 1gc1 (more details), 2.5 Å
SCOP Domain Sequences for d1gc1h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gc1h2 b.1.1.2 (H:130-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1gc1h2: