SCOPe 2.03: Domain d3l0ob2: 3l0o B:137-420

Lineage for d3l0ob2 (3l0o B:137-420)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [188476] (7 PDB entries)

8. Domain d3l0ob2: 3l0o B:137-420 [212640]
   Other proteins in same PDB: d3l0ob1
   automated match to d1xpoa3
   complexed with ium, na, so4

Details for d3l0ob2

PDB Entry: 3l0o, 2.35 Å

PDB Description: Structure of RNA-free Rho transcription termination factor from Thermotoga maritima

PDB Compounds: (B:) transcription termination factor rho

SCOPe Domain Sequences for d3l0ob2:

Sequence; same for both SEQRES and ATOM records:

>d3l0ob2 c.37.1.0 (B:137-420) automated matches {Thermotoga maritima [TaxId: 2336]}
rvnfdnltpdyprerfiletdpkiystrlidlfapigkgqrgmivappkagkttilkeia
ngiaenhpdtiriilliderpeevtdirestnaiviaapfdmppdkqvkvaeltlemakr
lvefnydvvilldsltrlarvynivvppsgklltggvdpaalykpkrffgaarntreggs
ltiiatalvetgskmdevifeefkgtgnmelvlsrqlankrifpainlllsgtrreelll
deetlkkvwllrrmlsamteeegltlilnklsetssneeflkli

Timeline for d3l0ob2:

• d3l0ob2 is new in SCOPe 2.03-stable
  
• d3l0ob2 appears in SCOPe 2.04
  
• d3l0ob2 appears in the current release, SCOPe 2.08