SCOPe 2.05: Domain d1gc1l2: 1gc1 L:110-213

Lineage for d1gc1l2 (1gc1 L:110-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1gc1l2: 1gc1 L:110-213 [21264]
   Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1
   part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
   complexed with nag

Details for d1gc1l2

PDB Entry: 1gc1, 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

PDB Compounds: (L:) antibody 17b

SCOPe Domain Sequences for d1gc1l2:

Sequence; same for both SEQRES and ATOM records:

>d1gc1l2 b.1.1.2 (L:110-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1gc1l2:

• d1gc1l2 first appeared (with stable ids) in SCOP 1.55
  
• d1gc1l2 appears in SCOPe 2.04
  
• d1gc1l2 appears in SCOPe 2.06
  
• d1gc1l2 appears in the current release, SCOPe 2.08