Lineage for d1gc1l2 (1gc1 L:110-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289670Domain d1gc1l2: 1gc1 L:110-213 [21264]
    Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1
    part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
    complexed with fuc, nag; mutant

Details for d1gc1l2

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

SCOP Domain Sequences for d1gc1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1l2 b.1.1.2 (L:110-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1gc1l2:

Click to download the PDB-style file with coordinates for d1gc1l2.
(The format of our PDB-style files is described here.)

Timeline for d1gc1l2: