Lineage for d1g9mh2 (1g9m H:130-229)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9181Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries)
  8. 9182Domain d1g9mh2: 1g9m H:130-229 [21263]
    Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh1, d1g9ml1

Details for d1g9mh2

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9mh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9mh2 b.1.1.2 (H:130-229) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1g9mh2:

Click to download the PDB-style file with coordinates for d1g9mh2.
(The format of our PDB-style files is described here.)

Timeline for d1g9mh2: