SCOPe 2.06: Domain d3l07a2: 3l07 A:121-281

Lineage for d3l07a2 (3l07 A:121-281)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [195722] (2 PDB entries)

8. Domain d3l07a2: 3l07 A:121-281 [212621]
   Other proteins in same PDB: d3l07a1, d3l07a3, d3l07b1, d3l07b3
   automated match to d1b0aa1
   complexed with act, edo, imd, po4

Details for d3l07a2

PDB Entry: 3l07, 1.88 Å

PDB Description: methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis.

PDB Compounds: (A:) Bifunctional protein folD

SCOPe Domain Sequences for d3l07a2:

Sequence; same for both SEQRES and ATOM records:

>d3l07a2 c.2.1.0 (A:121-281) automated matches {Francisella tularensis [TaxId: 177416]}
fhptnvgrlqlrdkkclesctpkgimtmlreygiktegayavvvgasnvvgkpvsqllln
akatvttchrfttdlkshttkadilivavgkpnfitadmvkegavvidvginhvdgkivg
dvdfaavkdkvaaitpvpggvgpmtitellyntfqcaqeln

Timeline for d3l07a2:

• d3l07a2 first appeared in SCOPe 2.03
  
• d3l07a2 appears in SCOPe 2.05
  
• d3l07a2 appears in SCOPe 2.07
  
• d3l07a2 appears in the current release, SCOPe 2.08