SCOP 1.65: Domain d1g9ml2: 1g9m L:110-214

Lineage for d1g9ml2 (1g9m L:110-214)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)

Domain d1g9ml2: 1g9m L:110-214 [21262]
Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml1
part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
complexed with fuc, ioh, nag; mutant

Details for d1g9ml2

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9ml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ml2 b.1.1.2 (L:110-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqk
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1g9ml2:

Click to download the PDB-style file with coordinates for d1g9ml2.
(The format of our PDB-style files is described here.)

Timeline for d1g9ml2: