Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries) |
Domain d1g9ml2: 1g9m L:110-214 [21262] Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh1, d1g9ml1 |
PDB Entry: 1g9m (more details), 2.2 Å
SCOP Domain Sequences for d1g9ml2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ml2 b.1.1.2 (L:110-214) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqk skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1g9ml2: