SCOPe 2.06: Domain d3kzub2: 3kzu B:260-420

Lineage for d3kzub2 (3kzu B:260-420)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Brucella melitensis [TaxId:29459] [225803] (1 PDB entry)

8. Domain d3kzub2: 3kzu B:260-420 [212609]
   automated match to d1j3na2
   complexed with edo, so4

Details for d3kzub2

PDB Entry: 3kzu, 1.75 Å

PDB Description: Crystal structure of 3-oxoacyl-(acyl carrier protein) synthase II from Brucella melitensis

PDB Compounds: (B:) 3-oxoacyl-(acyl-carrier-protein) synthase II

SCOPe Domain Sequences for d3kzub2:

Sequence; same for both SEQRES and ATOM records:

>d3kzub2 c.95.1.0 (B:260-420) automated matches {Brucella melitensis [TaxId: 29459]}
kiyaevigygmsgdafhitaptesgegaqrcmvaalkragivpdeidyinahgtstmadt
ielgavervvgeaaakismsstkssighllgaagaaeavfstlairdniapatlnldnpa
aqtridlvphkprerkidvalsnsfgfggtnaslvlrryta

Timeline for d3kzub2:

• d3kzub2 first appeared in SCOPe 2.03
  
• d3kzub2 appears in SCOPe 2.05
  
• d3kzub2 appears in SCOPe 2.07
  
• d3kzub2 appears in the current release, SCOPe 2.08