Lineage for d1a6tc2 (1a6t C:108-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516485Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1516683Domain d1a6tc2: 1a6t C:108-211 [21260]
    Other proteins in same PDB: d1a6ta1, d1a6tb1, d1a6tb2, d1a6tc1, d1a6td1, d1a6td2
    part of human rhinovirus 14 neutralizing Fab Mab1-IA

Details for d1a6tc2

PDB Entry: 1a6t (more details), 2.7 Å

PDB Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site
PDB Compounds: (C:) igg1 fab1-ia fab (light chain)

SCOPe Domain Sequences for d1a6tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6tc2 b.1.1.2 (C:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d1a6tc2:

Click to download the PDB-style file with coordinates for d1a6tc2.
(The format of our PDB-style files is described here.)

Timeline for d1a6tc2: