Lineage for d3kymk2 (3kym K:108-212)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030254Domain d3kymk2: 3kym K:108-212 [212599]
    Other proteins in same PDB: d3kyma1, d3kymc1, d3kyme1, d3kymg1, d3kymi1, d3kymk1, d3kymm1, d3kymo1
    automated match to d1rhha2

Details for d3kymk2

PDB Entry: 3kym (more details), 2.62 Å

PDB Description: Crystal structure of Li33 IgG2 di-Fab
PDB Compounds: (K:) Light Chain Li33 IgG2

SCOPe Domain Sequences for d3kymk2:

Sequence, based on SEQRES records: (download)

>d3kymk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Sequence, based on observed residues (ATOM records): (download)

>d3kymk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfpsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskd
styslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d3kymk2:

Click to download the PDB-style file with coordinates for d3kymk2.
(The format of our PDB-style files is described here.)

Timeline for d3kymk2: