Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d3kymg2: 3kym G:108-213 [212595] Other proteins in same PDB: d3kyma1, d3kymc1, d3kyme1, d3kymg1, d3kymi1, d3kymj_, d3kymk1, d3kyml_, d3kymm1, d3kymn_, d3kymo1, d3kymp_ automated match to d1rhha2 |
PDB Entry: 3kym (more details), 2.62 Å
SCOPe Domain Sequences for d3kymg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kymg2 b.1.1.2 (G:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d3kymg2: