Lineage for d3kymg2 (3kym G:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751917Domain d3kymg2: 3kym G:108-213 [212595]
    Other proteins in same PDB: d3kyma1, d3kymc1, d3kyme1, d3kymg1, d3kymi1, d3kymj_, d3kymk1, d3kyml_, d3kymm1, d3kymn_, d3kymo1, d3kymp_
    automated match to d1rhha2

Details for d3kymg2

PDB Entry: 3kym (more details), 2.62 Å

PDB Description: Crystal structure of Li33 IgG2 di-Fab
PDB Compounds: (G:) Light Chain Li33 IgG2

SCOPe Domain Sequences for d3kymg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kymg2 b.1.1.2 (G:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3kymg2:

Click to download the PDB-style file with coordinates for d3kymg2.
(The format of our PDB-style files is described here.)

Timeline for d3kymg2: