Lineage for d3kyjb_ (3kyj B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356558Species Rhodobacter sphaeroides [TaxId:1063] [225833] (2 PDB entries)
  8. 1356559Domain d3kyjb_: 3kyj B: [212587]
    automated match to d3c3ma_
    complexed with na

Details for d3kyjb_

PDB Entry: 3kyj (more details), 1.4 Å

PDB Description: crystal structure of the p1 domain of chea3 in complex with chey6 from r. sphaeroides
PDB Compounds: (B:) CheY6 protein

SCOPe Domain Sequences for d3kyjb_:

Sequence, based on SEQRES records: (download)

>d3kyjb_ c.23.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
gspynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlilldiem
pvmdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakpsgtvshdleek
tggelartmrtlmaa

Sequence, based on observed residues (ATOM records): (download)

>d3kyjb_ c.23.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
gspynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlilldiem
pvmdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakpsgtvktggela
rtmrtlmaa

SCOPe Domain Coordinates for d3kyjb_:

Click to download the PDB-style file with coordinates for d3kyjb_.
(The format of our PDB-style files is described here.)

Timeline for d3kyjb_: