SCOPe 2.03: Domain d3kxua_: 3kxu A:

Lineage for d3kxua_ (3kxu A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein (Apo)ferritin [47246] (8 species)

7. Species Human (Homo sapiens) [TaxId:9606] [187702] (7 PDB entries)

8. Domain d3kxua_: 3kxu A: [212581]
   automated match to d2fg4a_
   complexed with cd, so4; mutant

Details for d3kxua_

PDB Entry: 3kxu, 1.85 Å

PDB Description: Crystal structure of human ferritin FTL498InsTC pathogenic mutant

PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d3kxua_:

Sequence; same for both SEQRES and ATOM records:

>d3kxua_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
tdphlcdflethfldeevklikkmgdhltnlhrlgg

Timeline for d3kxua_:

• d3kxua_ is new in SCOPe 2.03-stable
  
• d3kxua_ appears in SCOPe 2.04
  
• d3kxua_ appears in the current release, SCOPe 2.08