Lineage for d1bgxh2 (1bgx H:116-209)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53958Species Fab TP7 (mouse), kappa L chain [49063] (2 PDB entries)
  8. 53961Domain d1bgxh2: 1bgx H:116-209 [21257]
    Other proteins in same PDB: d1bgxh1, d1bgxl1, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4

Details for d1bgxh2

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab

SCOP Domain Sequences for d1bgxh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgxh2 b.1.1.2 (H:116-209) Immunoglobulin (constant domains of L and H chains) {Fab TP7 (mouse), kappa L chain}
akttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1bgxh2:

Click to download the PDB-style file with coordinates for d1bgxh2.
(The format of our PDB-style files is described here.)

Timeline for d1bgxh2: