SCOPe 2.06: Domain d3kwxa2: 3kwx A:382-476

Lineage for d3kwxa2 (3kwx A:382-476)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Fungal alpha-amylase [51028] (2 species)

7. Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries)

8. Domain d3kwxa2: 3kwx A:382-476 [212569]
   Other proteins in same PDB: d3kwxa1
   automated match to d7taaa1
   complexed with ca, nag

Details for d3kwxa2

PDB Entry: 3kwx, 2.4 Å

PDB Description: chemically modified taka alpha-amylase

PDB Compounds: (A:) Alpha-amylase A type-1/2

SCOPe Domain Sequences for d3kwxa2:

Sequence; same for both SEQRES and ATOM records:

>d3kwxa2 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics

Timeline for d3kwxa2:

• d3kwxa2 first appeared in SCOPe 2.03
  
• d3kwxa2 appears in SCOPe 2.05
  
• d3kwxa2 appears in SCOPe 2.07
  
• d3kwxa2 appears in the current release, SCOPe 2.08