Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Fungal alpha-amylase [51028] (2 species) |
Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries) |
Domain d3kwxa2: 3kwx A:382-476 [212569] Other proteins in same PDB: d3kwxa1 automated match to d7taaa1 complexed with ca, nag |
PDB Entry: 3kwx (more details), 2.4 Å
SCOPe Domain Sequences for d3kwxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kwxa2 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct tvtvgsdgnvpvpmagglprvlypteklagskics
Timeline for d3kwxa2: