SCOPe 2.06: Domain d3kwjb1: 3kwj B:39-508

Lineage for d3kwjb1 (3kwj B:39-508)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (93 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d3kwjb1: 3kwj B:39-508 [212566]
   Other proteins in same PDB: d3kwja2, d3kwjb2
   automated match to d1nu6a1
   complexed with 23q, nag

Details for d3kwjb1

PDB Entry: 3kwj, 2.8 Å

PDB Description: structure of human dpp-iv with (2s,3s,11bs)-3-(3-fluoromethyl-phenyl)- 9,10-dimethoxy-1,3,4,6,7,11b-hexahydro-2h-pyrido[2,1-a]isoquinolin-2- ylamine

PDB Compounds: (B:) Dipeptidyl peptidase 4 soluble form

SCOPe Domain Sequences for d3kwjb1:

Sequence; same for both SEQRES and ATOM records:

>d3kwjb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d3kwjb1:

• d3kwjb1 first appeared in SCOPe 2.03
  
• d3kwjb1 appears in SCOPe 2.05
  
• d3kwjb1 appears in SCOPe 2.07
  
• d3kwjb1 appears in the current release, SCOPe 2.08