SCOPe 2.04: Domain d3ktlb1: 3ktl B:4-80

Lineage for d3ktlb1 (3ktl B:4-80)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (27 PDB entries)
   Uniprot P08263

8. Domain d3ktlb1: 3ktl B:4-80 [212541]
   Other proteins in same PDB: d3ktla2, d3ktlb2
   automated match to d1k3ya2
   complexed with gtx; mutant

Details for d3ktlb1

PDB Entry: 3ktl, 1.75 Å

PDB Description: crystal structure of an i71a human gsta1-1 mutant in complex with s- hexylglutathione

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d3ktlb1:

Sequence; same for both SEQRES and ATOM records:

>d3ktlb1 c.47.1.5 (B:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
klvqtraalnyiaskyn

Timeline for d3ktlb1:

• d3ktlb1 first appeared in SCOPe 2.03
  
• d3ktlb1 appears in SCOPe 2.05
  
• d3ktlb1 appears in the current release, SCOPe 2.08