SCOPe 2.07: Domain d3ks0a_: 3ks0 A:

Lineage for d3ks0a_ (3ks0 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
   beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)

4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families)

5. Family d.120.1.0: automated matches [191500] (1 protein)
   not a true family

6. Protein automated matches [190822] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225894] (1 PDB entry)

8. Domain d3ks0a_: 3ks0 A: [212527]
   Other proteins in same PDB: d3ks0j1, d3ks0j2, d3ks0l1, d3ks0l2
   automated match to d2ibja_
   complexed with hem

Details for d3ks0a_

PDB Entry: 3ks0, 2.7 Å

PDB Description: crystal structure of the heme domain of flavocytochrome b2 in complex with fab b2b4

PDB Compounds: (A:) Cytochrome b2, mitochondrial

SCOPe Domain Sequences for d3ks0a_:

Sequence; same for both SEQRES and ATOM records:

>d3ks0a_ d.120.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
hapnvidkyiapekklgplqgsmppelvcppy

Timeline for d3ks0a_:

• d3ks0a_ first appeared in SCOPe 2.03
  
• d3ks0a_ appears in SCOPe 2.06
  
• d3ks0a_ appears in the current release, SCOPe 2.08