Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Mentha x [TaxId:34256] [196410] (7 PDB entries) |
Domain d3krod1: 3kro D:2-295 [212522] Other proteins in same PDB: d3kroa2, d3krod2 automated match to d3oacd_ complexed with dst, edo, ipe, mg, ppv |
PDB Entry: 3kro (more details), 1.95 Å
SCOPe Domain Sequences for d3krod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3krod1 a.128.1.0 (D:2-295) automated matches {Mentha x [TaxId: 34256]} fdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvggd estampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfaf ehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhkt aallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkdl vadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn
Timeline for d3krod1: