SCOPe 2.08: Domain d3krod1: 3kro D:2-295

Lineage for d3krod1 (3kro D:2-295)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Mentha x [TaxId:34256] [196410] (7 PDB entries)

8. Domain d3krod1: 3kro D:2-295 [212522]
   Other proteins in same PDB: d3kroa2, d3krod2
   automated match to d3oacd_
   complexed with dst, edo, ipe, mg, ppv

Details for d3krod1

PDB Entry: 3kro, 1.95 Å

PDB Description: mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (ii)

PDB Compounds: (D:) Geranyl diphosphate synthase large subunit

SCOPe Domain Sequences for d3krod1:

Sequence; same for both SEQRES and ATOM records:

>d3krod1 a.128.1.0 (D:2-295) automated matches {Mentha x [TaxId: 34256]}
fdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvggd
estampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfaf
ehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhkt
aallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkdl
vadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn

Timeline for d3krod1:

• d3krod1 first appeared in SCOPe 2.03, called d3krod_
  
• d3krod1 appears in SCOPe 2.07