SCOPe 2.08: Domain d3kque1: 3kqu E:189-325

Lineage for d3kque1 (3kqu E:189-325)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain, N-terminal domain [418962] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419424] (17 PDB entries)

8. Domain d3kque1: 3kqu E:189-325 [212511]
   Other proteins in same PDB: d3kqua2, d3kqua3, d3kqub2, d3kqub3, d3kquc2, d3kquc3, d3kqud2, d3kqud3, d3kque2, d3kque3, d3kquf2, d3kquf3
   automated match to d1heia1
   protein/DNA complex; complexed with adp, bef, mn

Details for d3kque1

PDB Entry: 3kqu, 2.4 Å

PDB Description: three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism

PDB Compounds: (E:) Serine protease/NTPase/helicase NS3

SCOPe Domain Sequences for d3kque1:

Sequence; same for both SEQRES and ATOM records:

>d3kque1 c.37.1.14 (E:189-325) HCV helicase domain, N-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
qaetagarlvvlatatp

Timeline for d3kque1:

• d3kque1 first appeared in SCOPe 2.03
  
• d3kque1 appears in SCOPe 2.07