Lineage for d1c1eh2 (1c1e H:120-228)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221180Species Diels-Alder catalytic Fab 1E9 (mouse), kappa L chain [49061] (1 PDB entry)
  8. 221181Domain d1c1eh2: 1c1e H:120-228 [21251]
    Other proteins in same PDB: d1c1eh1, d1c1el1
    complexed with dmr, enh

Details for d1c1eh2

PDB Entry: 1c1e (more details), 1.9 Å

PDB Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten

SCOP Domain Sequences for d1c1eh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1eh2 b.1.1.2 (H:120-228) Immunoglobulin (constant domains of L and H chains) {Diels-Alder catalytic Fab 1E9 (mouse), kappa L chain}
svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1c1eh2:

Click to download the PDB-style file with coordinates for d1c1eh2.
(The format of our PDB-style files is described here.)

Timeline for d1c1eh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1eh1