Lineage for d1a4ja2 (1a4j A:113-217)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289649Domain d1a4ja2: 1a4j A:113-217 [21244]
    Other proteins in same PDB: d1a4ja1, d1a4jb1, d1a4jb2, d1a4jh1, d1a4jh2, d1a4jl1
    part of humanized Diels-Alder catalytic Fab

Details for d1a4ja2

PDB Entry: 1a4j (more details), 2.1 Å

PDB Description: diels alder catalytic antibody germline precursor

SCOP Domain Sequences for d1a4ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4ja2 b.1.1.2 (A:113-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1a4ja2:

Click to download the PDB-style file with coordinates for d1a4ja2.
(The format of our PDB-style files is described here.)

Timeline for d1a4ja2: