Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab Desire-1 (mouse), kappa L chain [49059] (1 PDB entry) |
Domain d1kb5h2: 1kb5 H:114-213 [21241] Other proteins in same PDB: d1kb5a_, d1kb5b_, d1kb5h1, d1kb5l1 |
PDB Entry: 1kb5 (more details), 2.5 Å
SCOP Domain Sequences for d1kb5h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb5h2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Fab Desire-1 (mouse), kappa L chain} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1kb5h2:
View in 3D Domains from other chains: (mouse over for more information) d1kb5a_, d1kb5b_, d1kb5l1, d1kb5l2 |