Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225832] (2 PDB entries) |
Domain d3kk8a_: 3kk8 A: [212400] automated match to d3bhhd_ complexed with mg |
PDB Entry: 3kk8 (more details), 1.72 Å
SCOPe Domain Sequences for d3kk8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kk8a_ d.144.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} stkfsdnydvkeelgkgafsvvrrcvhkttglefaakiintkklsardfqklerearicr klqhpnivrlhdsiqeesfhylvfdlvtggelfedivarefyseadashciqqilesiay chsngivhrnlkpenlllaskakgaavkladfglaievndseawhgfagtpgylspevlk kdpyskpvdiwacgvilyillvgyppfwdedqhrlyaqikagaydypspewdtvtpeaks lidsmltvnpkkritadqalkvpwicnrervasaihrqdtvdcl
Timeline for d3kk8a_: