Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) |
Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
Protein automated matches [193326] (11 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [225939] (5 PDB entries) |
Domain d3kk0a_: 3kk0 A: [212395] automated match to d4jy7a_ complexed with bme, edo, ipa, peg |
PDB Entry: 3kk0 (more details), 2.65 Å
SCOPe Domain Sequences for d3kk0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kk0a_ c.56.3.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} maepllvvglgnpgptyaktrhnlgfmvadvlagrigsafkvhkksgaevvtgrlagttv vlakprismnesgrqvgplakfysvppqqivvihdeldidfgrirlklgggegghnglrs vasalgtknfhrvrigvgrppgrkdpaafvlenftsaeraevptiveqaadatelliaqg lepaqntvhaw
Timeline for d3kk0a_: