SCOPe 2.07: Domain d3kjdb1: 3kjd B:235-364

Lineage for d3kjdb1 (3kjd B:235-364)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)

8. Domain d3kjdb1: 3kjd B:235-364 [212390]
   Other proteins in same PDB: d3kjda2, d3kjda3, d3kjdb2, d3kjdb3
   automated match to d1gs0a1
   protein/DNA complex; complexed with 78p, gol

Details for d3kjdb1

PDB Entry: 3kjd, 1.95 Å

PDB Description: Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor ABT-888

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d3kjdb1:

Sequence; same for both SEQRES and ATOM records:

>d3kjdb1 a.41.1.0 (B:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh
gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelqsp
ehpldqhyrn

Timeline for d3kjdb1:

• d3kjdb1 first appeared in SCOPe 2.03
  
• d3kjdb1 appears in SCOPe 2.06
  
• d3kjdb1 appears in the current release, SCOPe 2.08