SCOP 1.73: Domain d1gpom2: 1gpo M:113-218

Lineage for d1gpom2 (1gpo M:113-218)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
Domain d1gpom2: 1gpo M:113-218 [21238]
Other proteins in same PDB: d1gpoh1, d1gpoh2, d1gpoi1, d1gpoi2, d1gpol1, d1gpom1
part of Fab M41 (artificial design)
complexed with so4

Details for d1gpom2

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

PDB Compounds: (M:) antibody m41

SCOP Domain Sequences for d1gpom2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpom2 b.1.1.2 (M:113-218) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1gpom2:

Click to download the PDB-style file with coordinates for d1gpom2.
(The format of our PDB-style files is described here.)

Timeline for d1gpom2: