SCOP 1.61: Domain d1gpom2: 1gpo M:113-218

Lineage for d1gpom2 (1gpo M:113-218)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab M41 (artificial design) [49058] (1 PDB entry)

8. Domain d1gpom2: 1gpo M:113-218 [21238]
   Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpom1

Details for d1gpom2

PDB Entry: 1gpo, 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpom2:

Sequence; same for both SEQRES and ATOM records:

>d1gpom2 b.1.1.2 (M:113-218) Immunoglobulin (constant domains of L and H chains) {Fab M41 (artificial design)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1gpom2:

• d1gpom2 first appeared (with stable ids) in SCOP 1.55
  
• d1gpom2 appears in SCOP 1.59
  
• d1gpom2 appears in SCOP 1.63
  
• d1gpom2 appears in the current release, SCOPe 2.08