Lineage for d1gpoh2 (1gpo H:114-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655439Domain d1gpoh2: 1gpo H:114-214 [21237]
    Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpol2, d1gpom1, d1gpom2

Details for d1gpoh2

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment
PDB Compounds: (H:) antibody m41

SCOP Domain Sequences for d1gpoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpoh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1gpoh2:

Click to download the PDB-style file with coordinates for d1gpoh2.
(The format of our PDB-style files is described here.)

Timeline for d1gpoh2: