SCOP 1.67: Domain d1gpoh2: 1gpo H:114-214

Lineage for d1gpoh2 (1gpo H:114-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1gpoh2: 1gpo H:114-214 [21237]
   Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpol2, d1gpom1, d1gpom2

Details for d1gpoh2

PDB Entry: 1gpo, 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpoh2:

Sequence; same for both SEQRES and ATOM records:

>d1gpoh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Timeline for d1gpoh2:

• d1gpoh2 first appeared (with stable ids) in SCOP 1.55
  
• d1gpoh2 appears in SCOP 1.65
  
• d1gpoh2 appears in SCOP 1.69
  
• d1gpoh2 appears in the current release, SCOPe 2.08