Lineage for d1gpoh2 (1gpo H:114-214)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104296Species Fab M41 (artificial design) [49058] (1 PDB entry)
  8. 104297Domain d1gpoh2: 1gpo H:114-214 [21237]
    Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpom1

Details for d1gpoh2

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpoh2 b.1.1.2 (H:114-214) Immunoglobulin (constant domains of L and H chains) {Fab M41 (artificial design)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1gpoh2:

Click to download the PDB-style file with coordinates for d1gpoh2.
(The format of our PDB-style files is described here.)

Timeline for d1gpoh2: