Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab M41 (artificial design) [49058] (1 PDB entry) |
Domain d1gpoh2: 1gpo H:114-214 [21237] Other proteins in same PDB: d1gpoh1, d1gpoi1, d1gpol1, d1gpom1 |
PDB Entry: 1gpo (more details), 1.95 Å
SCOP Domain Sequences for d1gpoh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpoh2 b.1.1.2 (H:114-214) Immunoglobulin (constant domains of L and H chains) {Fab M41 (artificial design)} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
Timeline for d1gpoh2: