SCOPe 2.02: Domain d1gpol2: 1gpo L:113-216

Lineage for d1gpol2 (1gpo L:113-216)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Mouse (Mus musculus) [TaxId:10090] [88567] (317 PDB entries)
Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

Domain d1gpol2: 1gpo L:113-216 [21236]
Other proteins in same PDB: d1gpoh1, d1gpoh2, d1gpoi1, d1gpoi2, d1gpol1, d1gpom1
part of Fab M41 (artificial design)
complexed with so4

Details for d1gpol2

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

PDB Compounds: (L:) antibody m41

SCOPe Domain Sequences for d1gpol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpol2 b.1.1.2 (L:113-216) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d1gpol2:

Click to download the PDB-style file with coordinates for d1gpol2.
(The format of our PDB-style files is described here.)

Timeline for d1gpol2: