SCOPe 2.05: Domain d3kgaa_: 3kga A:

Lineage for d3kgaa_ (3kga A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
   CaMK group; MAPKAPK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [82790] (15 PDB entries)

8. Domain d3kgaa_: 3kga A: [212350]
   automated match to d1nxkc_
   complexed with lx9, mg

Details for d3kgaa_

PDB Entry: 3kga, 2.55 Å

PDB Description: crystal structure of mapkap kinase 2 (mk2) complexed with a potent 3- aminopyrazole atp site inhibitor

PDB Compounds: (A:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d3kgaa_:

Sequence, based on SEQRES records:

>d3kgaa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkmlirnllk
teptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

Sequence, based on observed residues (ATOM records):

>d3kgaa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfyspgmktrirmgqyefpnpewsevseevkmlirnllkteptqrm
titefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

Timeline for d3kgaa_:

• d3kgaa_ first appeared in SCOPe 2.03
  
• d3kgaa_ appears in SCOPe 2.04
  
• d3kgaa_ appears in SCOPe 2.06
  
• d3kgaa_ appears in the current release, SCOPe 2.08