Lineage for d1jrhh2 (1jrh H:114-221)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159670Species Fab A6 (mouse), kappa L chain [49057] (1 PDB entry)
  8. 159671Domain d1jrhh2: 1jrh H:114-221 [21235]
    Other proteins in same PDB: d1jrhh1, d1jrhi_, d1jrhl1

Details for d1jrhh2

PDB Entry: 1jrh (more details), 2.8 Å

PDB Description: complex (antibody/antigen)

SCOP Domain Sequences for d1jrhh2:

Sequence, based on SEQRES records: (download)

>d1jrhh2 b.1.1.2 (H:114-221) Immunoglobulin (constant domains of L and H chains) {Fab A6 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdk

Sequence, based on observed residues (ATOM records): (download)

>d1jrhh2 b.1.1.2 (H:114-221) Immunoglobulin (constant domains of L and H chains) {Fab A6 (mouse), kappa L chain}
akttpclvyfpepvtvtwnsgssgvhtfpavlqsdlytlsssvtcnvahpasstkvdk

SCOP Domain Coordinates for d1jrhh2:

Click to download the PDB-style file with coordinates for d1jrhh2.
(The format of our PDB-style files is described here.)

Timeline for d1jrhh2: