Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
Protein automated matches [190652] (6 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [225983] (2 PDB entries) |
Domain d3ke4c_: 3ke4 C: [212345] automated match to d3ci4a_ complexed with dio |
PDB Entry: 3ke4 (more details), 1.9 Å
SCOPe Domain Sequences for d3ke4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ke4c_ a.25.2.0 (C:) automated matches {Bacillus cereus [TaxId: 226900]} gttsviggrvdkddirveaygtideanshigyamtklqggafidiyneleniqhelfdcg gdlaiveqkipykvtivmveslerkidlyieeapplerfilpggseaaatihiartvvrr aersivslqkevkinevvlkyvnrlsdylfaiarvinarlqvkdveynr
Timeline for d3ke4c_: