SCOP 1.73: Domain d1jrhl2: 1jrh L:108-207

Lineage for d1jrhl2 (1jrh L:108-207)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1jrhl2: 1jrh L:108-207 [21234]
   Other proteins in same PDB: d1jrhh1, d1jrhh2, d1jrhi_, d1jrhl1
   part of Fab A6
   mutant

Details for d1jrhl2

PDB Entry: 1jrh, 2.8 Å

PDB Description: complex (antibody/antigen)

PDB Compounds: (L:) antibody a6

SCOP Domain Sequences for d1jrhl2:

Sequence, based on SEQRES records:

>d1jrhl2 b.1.1.2 (L:108-207) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivk

Sequence, based on observed residues (ATOM records):

>d1jrhl2 b.1.1.2 (L:108-207) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifpcflnnfypkdinvkgvlnswtdqdskdstysmsstceathktstspiv
k

Timeline for d1jrhl2:

• d1jrhl2 first appeared (with stable ids) in SCOP 1.55
  
• d1jrhl2 appears in SCOP 1.71
  
• d1jrhl2 appears in SCOP 1.75
  
• d1jrhl2 appears in the current release, SCOPe 2.08