SCOP 1.55: Domain d1jrhl2: 1jrh L:108-207

Lineage for d1jrhl2 (1jrh L:108-207)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab A6 (mouse), kappa L chain [49057] (1 PDB entry)

8. Domain d1jrhl2: 1jrh L:108-207 [21234]
   Other proteins in same PDB: d1jrhh1, d1jrhi_, d1jrhl1

Details for d1jrhl2

PDB Entry: 1jrh, 2.8 Å

PDB Description: complex (antibody/antigen)

SCOP Domain Sequences for d1jrhl2:

Sequence, based on SEQRES records:

>d1jrhl2 b.1.1.2 (L:108-207) Immunoglobulin (constant domains of L and H chains) {Fab A6 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivk

Sequence, based on observed residues (ATOM records):

>d1jrhl2 b.1.1.2 (L:108-207) Immunoglobulin (constant domains of L and H chains) {Fab A6 (mouse), kappa L chain}
radaaptvsifpcflnnfypkdinvkgvlnswtdqdskdstysmsstceathktstspiv
k

Timeline for d1jrhl2:

• d1jrhl2 appears in SCOP 1.57
  
• d1jrhl2 appears in the current release, SCOPe 2.08