Lineage for d1jrhl2 (1jrh L:108-207)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8804Species Fab A6 (mouse), kappa L chain [49057] (1 PDB entry)
  8. 8806Domain d1jrhl2: 1jrh L:108-207 [21234]
    Other proteins in same PDB: d1jrhh1, d1jrhi_, d1jrhl1

Details for d1jrhl2

PDB Entry: 1jrh (more details), 2.8 Å

PDB Description: complex (antibody/antigen)

SCOP Domain Sequences for d1jrhl2:

Sequence, based on SEQRES records: (download)

>d1jrhl2 b.1.1.2 (L:108-207) Immunoglobulin (constant domains of L and H chains) {Fab A6 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivk

Sequence, based on observed residues (ATOM records): (download)

>d1jrhl2 b.1.1.2 (L:108-207) Immunoglobulin (constant domains of L and H chains) {Fab A6 (mouse), kappa L chain}
radaaptvsifpcflnnfypkdinvkgvlnswtdqdskdstysmsstceathktstspiv
k

SCOP Domain Coordinates for d1jrhl2:

Click to download the PDB-style file with coordinates for d1jrhl2.
(The format of our PDB-style files is described here.)

Timeline for d1jrhl2: